PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015896806.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family ARR-B
Protein Properties Length: 563aa    MW: 62764.7 Da    PI: 6.0392
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015896806.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.84.9e-28319372256
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      +++WtpeLH++Fv+aveqL G ++A+P++ilelmkv+gLt+++v+SHLQkYR++
  XP_015896806.1 319 IKVDWTPELHKKFVQAVEQL-GVDQAIPSRILELMKVEGLTRHNVASHLQKYRMH 372
                     5899****************.********************************96 PP

2Response_reg27.61.5e-10201261109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl+vd + + +  +r+ le  +y +v ++ + +eal  +  k   +++ +  ++ +++d  e +k +++++ +lp i+ +     +++ +++ +G
  XP_015896806.1  20 VLVVDGDSNSAAEMRSKLEAMDY-VVFTFCNVTEALSAFSSKPesFHVAIAEVNTSDVD--ESFKFLENAK-DLPTIMTSNIHCLNTMMKCIALG 110
                     89*********************.***************766666*******9998866..7778887777.99***9999889*********** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a +fl Kp + e+l++
  XP_015896806.1 111 AVEFLRKPLSDEKLRN 126
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.42E-1616134IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.7E-1616139No hitNo description
SMARTSM004480.00818128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011020.73719132IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.6E-820127IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.25E-921131No hitNo description
PROSITE profilePS5129416.251315374IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-27316374IPR009057Homeodomain-like
SuperFamilySSF466892.06E-18317375IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-25318373IPR006447Myb domain, plants
PfamPF002491.0E-8321370IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MVCTANDLQG WKDFPKGLRV LVVDGDSNSA AEMRSKLEAM DYVVFTFCNV TEALSAFSSK  60
PESFHVAIAE VNTSDVDESF KFLENAKDLP TIMTSNIHCL NTMMKCIALG AVEFLRKPLS  120
DEKLRNIWQH VVHKAFNAGG GLLSKPDKHV KESIVSTLQL KLEKDGEPND KISMENENVD  180
EIQENDPEQS PGSDKYPAPS TPQLKQGTRL LDDGDCQDQT NCSTEKENGE QDSESKSVET  240
TCCNTIVEGA LSTGQPQMQE NTTVKEEEDS ADGSKNENDM LSHPHNDGSF NNISSGAEIP  300
RKASGLNNLC GSKSNRKKIK VDWTPELHKK FVQAVEQLGV DQAIPSRILE LMKVEGLTRH  360
NVASHLQKYR MHKRHILPKE EDRRWPHHRD PMQRNYYPHK PIMAFPPYHS SHALAMPPIY  420
PMWGQPGGHP ASVQMWQTPP PNYNPWQPTE SWHWKPYTGM HADAWGCPVM PPHGPYPSYP  480
QTAAAGYPNA GVVDNIGLSM PQNSFELHPA EEVIDKVVKE AISKPWLPLP LGLKPPSTDG  540
VLAELSKQGI CRIPPQINGY NSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-16316371358ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015896804.10.0PREDICTED: two-component response regulator-like APRR2
RefseqXP_015896805.10.0PREDICTED: two-component response regulator-like APRR2
RefseqXP_015896806.10.0PREDICTED: two-component response regulator-like APRR2
SwissprotQ6LA431e-150APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLW9RZ290.0W9RZ29_9R
STRINGVIT_02s0012g00570.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-153ARR-B family protein